PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA167G00006
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family BES1
Protein Properties Length: 127aa    MW: 14306.2 Da    PI: 10.7049
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA167G00006genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822159.62.1e-491082173
       DUF822  1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgs 73
                 ++++rkp+w+ErEnn+rRERrRRa+aakiy+GLRaqGny+lpk++DnneVlkALc+eAGwvve+DGttyrk  
  AA167G00006 10 AAARRKPSWRERENNRRRERRRRAVAAKIYSGLRAQGNYNLPKHCDNNEVLKALCAEAGWVVEEDGTTYRKNV 82
                 5899******************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.5E-451295IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MTSDGATLAA AARRKPSWRE RENNRRRERR RRAVAAKIYS GLRAQGNYNL PKHCDNNEVL  60
KALCAEAGWV VEEDGTTYRK NVIITSAGSW KLVGFGFAVS AAQAGNLDNR KMDLLNYGRK  120
MEFSIRD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11231RRKPSWRERENNRRRERRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006473462.17e-37PREDICTED: protein BRASSINAZOLE-RESISTANT 1
RefseqXP_007017466.19e-37Brassinosteroid signaling positive regulator family protein
SwissprotQ9LN632e-33BZR2_ARATH; Protein BRASSINAZOLE-RESISTANT 2
TrEMBLA0A061FCF51e-36A0A061FCF5_THECC; Brassinosteroid signaling positive regulator family protein
TrEMBLA0A067H0K18e-37A0A067H0K1_CITSI; Uncharacterized protein
TrEMBLA0A151TBZ76e-37A0A151TBZ7_CAJCA; Protein BRASSINAZOLE-RESISTANT 1
STRINGGLYMA06G03700.18e-36(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM155111117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.65e-34BES1 family protein